PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN34496.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 310aa    MW: 35206.9 Da    PI: 5.9967
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN34496.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.4e-141358146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEde l++ vk++G+++W++I ++  + Rt+k+c++rw +
       KHN34496.1 13 KGPWKAEEDEMLLNHVKKYGPRDWSSIRSKGLLQRTGKSCRLRWVN 58
                     79*************************8887799**********87 PP

2Myb_DNA-binding43.95.3e-1469108344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      +++ eE+   +++ +qlG++ W++Ia++++ gRt++++k++w
       KHN34496.1  69 KFSLEEERVVIELQAQLGNR-WAKIASYLP-GRTDNDVKNFW 108
                      799*****************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-21661IPR009057Homeodomain-like
PROSITE profilePS5129419.838864IPR017930Myb domain
SuperFamilySSF466891.42E-2811108IPR009057Homeodomain-like
SMARTSM007171.3E-111262IPR001005SANT/Myb domain
CDDcd001674.12E-121560No hitNo description
PfamPF139211.1E-121674No hitNo description
Gene3DG3DSA:1.10.10.609.7E-1862114IPR009057Homeodomain-like
PROSITE profilePS5129418.09565116IPR017930Myb domain
SMARTSM007171.1E-1266114IPR001005SANT/Myb domain
CDDcd001678.84E-1169108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MHGKKEQEEY IRKGPWKAEE DEMLLNHVKK YGPRDWSSIR SKGLLQRTGK SCRLRWVNKL  60
RPNLKNGCKF SLEEERVVIE LQAQLGNRWA KIASYLPGRT DNDVKNFWSS RQKRLARILQ  120
TSATPKSQKN KTRVPSLHDV PILQPPKFSS PSEGEPSSKP QSCSLPYIDN SEVIKMVSLP  180
DLIKSELPSS DTIHVEQEFT LFENYKSTEQ IAFPQIPELQ NGLTFSMENQ DLLPTIDEPC  240
FIEELCPLDA SEFGIGPQHP IGFPFFQPPG SCRLGTGDAI DNSKISDSFF DDFPVDMFDH  300
MDPPASPSNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-291111425126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150421e-116AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014632897.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0B2RIR70.0A0A0B2RIR7_GLYSO; Transcription factor GAMYB
STRINGGLYMA07G14480.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.14e-86MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]